LL-37 5mg – High-Purity Antimicrobial Research Peptide
LL-37 (also known as CAP-18) is a synthetic antimicrobial peptide belonging to the cathelicidin family, widely studied in preclinical research for its immune-modulating, antibacterial, antiviral, and tissue-repair properties. Supplied in lyophilised (freeze-dried) form for maximum stability, this compound is verified at >99.1% purity (HPLC-tested) and includes a full Certificate of Analysis (COA).
What is LL-37?
LL-37 is a naturally occurring peptide fragment derived from the human cathelicidin antimicrobial protein (hCAP-18). Researchers have investigated LL-37 for its role in innate immunity, inflammation regulation, and cellular regeneration.
Bluewell Peptides supplies LL-37 strictly for laboratory research use only, ensuring each batch is tested and verified for purity, stability, and composition transparency.
Scientific Identifiers
-
Product Name: LL-37 5mg
-
Catalogue Number: BWP-LL37-5
-
CAS Number: 154947-66-7
-
Molecular Formula: C₂₀₃H₃₄₅N₆₁O₄₉S
-
Molecular Weight: 4493.34 g/mol
-
Sequence: [LL-37, 37 aa]
-
Form: Lyophilised Solid
-
Purity: >99.1% (HPLC Verified)
-
Storage: Store at −20°C, protected from light
-
Unit Size: 5mg
Usage and Reconstitution
LL-37 is supplied as a lyophilised solid for stability during storage and transport. For laboratory use, it may be reconstituted with bacteriostatic water or other appropriate solvents under aseptic conditions. Refer to our peptide reconstitution page for full guidance.
Why Order LL-37 from Bluewell Peptides?
-
99.1% purity, HPLC-verified
-
COA provided with every batch
-
Secure ordering and fast UK delivery
-
Transparent, research-focused supplier
-
Excellent customer support and trusted reviews
Legal and Safety Information
Bluewell Peptides products are supplied strictly for laboratory research and educational purposes only. They are not approved for human or veterinary use. These compounds are not intended to diagnose, treat, cure, or prevent any disease. Use must comply with all applicable laws and regulations.
